Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55564] (38 PDB entries) |
Domain d3kfja_: 3kfj A: [179335] automated match to d1fhsa_ complexed with cl, mg, yen |
PDB Entry: 3kfj (more details), 2.02 Å
SCOPe Domain Sequences for d3kfja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kfja_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} kphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvp
Timeline for d3kfja_: