Lineage for d3kffa_ (3kff A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551687Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1551688Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1551689Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1552080Protein automated matches [190163] (13 species)
    not a true protein
  7. 1552135Species Mouse (Mus musculus) [TaxId:10090] [188249] (10 PDB entries)
  8. 1552136Domain d3kffa_: 3kff A: [179331]
    automated match to d1df3a_
    complexed with cl, xbt, zbt

Details for d3kffa_

PDB Entry: 3kff (more details), 0.96 Å

PDB Description: major mouse urinary protein iv complexed with 2-sec-butyl-4,5- dihydrothiazole
PDB Compounds: (A:) Major urinary protein 4

SCOPe Domain Sequences for d3kffa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kffa_ b.60.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lnvekingewfsillasdkrekieehgsmrvfvehihvlenslafkfhtvidgecseifl
vadktekageysvmydgfntftilktdydnyimfhlinekdgktfqlmelygrkadlnsd
ikekfvklceehgiikeniidltktnrclkar

SCOPe Domain Coordinates for d3kffa_:

Click to download the PDB-style file with coordinates for d3kffa_.
(The format of our PDB-style files is described here.)

Timeline for d3kffa_: