SCOPe 2.07: Domain d3k8db_: 3k8d B:

Lineage for d3k8db_ (3k8d B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)

6. Protein automated matches [190992] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [189106] (1 PDB entry)

8. Domain d3k8db_: 3k8d B: [179184]
   automated match to d1vh1a_
   complexed with ctp, kdo, mg

Details for d3k8db_

PDB Entry: 3k8d, 1.9 Å

PDB Description: crystal structure of e. coli lipopolysaccharide specific cmp-kdo synthetase in complex with ctp and 2-deoxy-kdo

PDB Compounds: (B:) 3-deoxy-manno-octulosonate cytidylyltransferase

SCOPe Domain Sequences for d3k8db_:

Sequence; same for both SEQRES and ATOM records:

>d3k8db_ c.68.1.13 (B:) automated matches {Escherichia coli [TaxId: 562]}
sfvviiparyastrlpgkplvdingkpmivhvleraresgaeriivatdhedvaraveaa
ggevcmtradhqsgterlaevvekcafsddtvivnvqgdepmipatiirqvadnlaqrqv
gmatlavpihnaeeafnpnavkvvldaegyalyfsratipwdrdrfaegletvgdnflrh
lgiygyragfirryvnwqpsplehiemleqlrvlwygekihvavaqevpgtgvdtpedle
rvraem

Timeline for d3k8db_:

• d3k8db_ first appeared in SCOPe 2.01
  
• d3k8db_ appears in SCOPe 2.06
  
• d3k8db_ appears in the current release, SCOPe 2.08