Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) contains one classic and one pseudo HhH motifs |
Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins) |
Protein automated matches [191020] (3 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [189388] (2 PDB entries) |
Domain d3k4gh_: 3k4g H: [179074] automated match to d1cooa_ complexed with na |
PDB Entry: 3k4g (more details), 2.05 Å
SCOPe Domain Sequences for d3k4gh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k4gh_ a.60.3.1 (H:) automated matches {Escherichia coli K-12 [TaxId: 83333]} kpefdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikd vlasrglslgmrlenwppasiad
Timeline for d3k4gh_: