Class a: All alpha proteins [46456] (179 folds) |
Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (2 families) dimer of identical subunits |
Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins) |
Protein Transcription factor 1, TF1 [47738] (1 species) |
Species Bacteriophage SPO1 [TaxId:10685] [47739] (2 PDB entries) |
Domain d1exea_: 1exe A: [17906] |
PDB Entry: 1exe (more details)
SCOP Domain Sequences for d1exea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exea_ a.55.1.1 (A:) Transcription factor 1, TF1 {Bacteriophage SPO1} mnktelikaiaqdtgltqvsvskmlasfekiitetvakgdkvqltgflnikpvarqarkg fnpqtqealeiapsvgvsvkpgeslkkaaeglkyedfak
Timeline for d1exea_: