Lineage for d1exea_ (1exe A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282161Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 282162Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (2 families) (S)
    dimer of identical subunits
  5. 282163Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins)
  6. 282195Protein Transcription factor 1, TF1 [47738] (1 species)
  7. 282196Species Bacteriophage SPO1 [TaxId:10685] [47739] (2 PDB entries)
  8. 282197Domain d1exea_: 1exe A: [17906]

Details for d1exea_

PDB Entry: 1exe (more details)

PDB Description: solution structure of a mutant of transcription factor 1.

SCOP Domain Sequences for d1exea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exea_ a.55.1.1 (A:) Transcription factor 1, TF1 {Bacteriophage SPO1}
mnktelikaiaqdtgltqvsvskmlasfekiitetvakgdkvqltgflnikpvarqarkg
fnpqtqealeiapsvgvsvkpgeslkkaaeglkyedfak

SCOP Domain Coordinates for d1exea_:

Click to download the PDB-style file with coordinates for d1exea_.
(The format of our PDB-style files is described here.)

Timeline for d1exea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1exeb_