SCOPe 2.08: Domain d1exea_: 1exe A:

Lineage for d1exea_ (1exe A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
   automatically mapped to Pfam PF00216

6. Protein Transcription factor 1, TF1 [47738] (1 species)

7. Species Bacteriophage SPO1 [TaxId:10685] [47739] (2 PDB entries)

8. Domain d1exea_: 1exe A: [17906]
   mutant

Details for d1exea_

PDB Entry: 1exe

PDB Description: solution structure of a mutant of transcription factor 1.

PDB Compounds: (A:) transcription factor 1

SCOPe Domain Sequences for d1exea_:

Sequence; same for both SEQRES and ATOM records:

>d1exea_ a.55.1.1 (A:) Transcription factor 1, TF1 {Bacteriophage SPO1 [TaxId: 10685]}
mnktelikaiaqdtgltqvsvskmlasfekiitetvakgdkvqltgflnikpvarqarkg
fnpqtqealeiapsvgvsvkpgeslkkaaeglkyedfak

Timeline for d1exea_:

• d1exea_ first appeared (with stable ids) in SCOP 1.55
  
• d1exea_ appears in SCOPe 2.07