Lineage for d3k3am_ (3k3a M:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1134683Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1134684Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1134685Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 1134698Protein Influenza neuraminidase [50943] (2 species)
  7. 1134788Species Influenza B virus, different strains [TaxId:11520] [50945] (17 PDB entries)
  8. 1134854Domain d3k3am_: 3k3a M: [179032]
    automated match to d1a4ga_
    complexed with ca, g39, nag, yt3; mutant

Details for d3k3am_

PDB Entry: 3k3a (more details), 2.59 Å

PDB Description: crystal structure of b/perth neuraminidase d197e mutant in complex with oseltamivir
PDB Compounds: (M:) Neuraminidase

SCOPe Domain Sequences for d3k3am_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k3am_ b.68.1.1 (M:) Influenza neuraminidase {Influenza B virus, different strains [TaxId: 11520]}
pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
whsaataiyclmgsgqllwdtvtgvdmal

SCOPe Domain Coordinates for d3k3am_:

Click to download the PDB-style file with coordinates for d3k3am_.
(The format of our PDB-style files is described here.)

Timeline for d3k3am_: