SCOP 1.65: Domain d1b8zb_: 1b8z B:

Lineage for d1b8zb_ (1b8z B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (2 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins)

6. Protein HU protein [47735] (3 species)

7. Species Thermotoga maritima [TaxId:243274] [47737] (1 PDB entry)

8. Domain d1b8zb_: 1b8z B: [17903]

Details for d1b8zb_

PDB Entry: 1b8z, 1.6 Å

PDB Description: hu from thermotoga maritima

SCOP Domain Sequences for d1b8zb_:

Sequence, based on SEQRES records:

>d1b8zb_ a.55.1.1 (B:) HU protein {Thermotoga maritima}
mnkkelidrvakkagakkkdvklildtiletitealakgekvqivgfgsfevrkaaarkg
vnpqtrkpitiperkvpkfkpgkalkekvk

Sequence, based on observed residues (ATOM records):

>d1b8zb_ a.55.1.1 (B:) HU protein {Thermotoga maritima}
mnkkelidrvakkagakkkdvklildtiletitealakgekvqivgfgsfevvpkfkpgk
alkekvk

Timeline for d1b8zb_:

• d1b8zb_ first appeared (with stable ids) in SCOP 1.55
  
• d1b8zb_ appears in SCOP 1.63
  
• d1b8zb_ appears in SCOP 1.67
  
• d1b8zb_ appears in the current release, SCOPe 2.08