| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) ![]() dimer of identical subunits |
| Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins) automatically mapped to Pfam PF00216 |
| Protein HU protein [47735] (5 species) |
| Species Thermotoga maritima [TaxId:2336] [47737] (2 PDB entries) Uniprot P36206 |
| Domain d1b8zb_: 1b8z B: [17903] |
PDB Entry: 1b8z (more details), 1.6 Å
SCOPe Domain Sequences for d1b8zb_:
Sequence, based on SEQRES records: (download)
>d1b8zb_ a.55.1.1 (B:) HU protein {Thermotoga maritima [TaxId: 2336]}
mnkkelidrvakkagakkkdvklildtiletitealakgekvqivgfgsfevrkaaarkg
vnpqtrkpitiperkvpkfkpgkalkekvk
>d1b8zb_ a.55.1.1 (B:) HU protein {Thermotoga maritima [TaxId: 2336]}
mnkkelidrvakkagakkkdvklildtiletitealakgekvqivgfgsfevvpkfkpgk
alkekvk
Timeline for d1b8zb_: