Lineage for d1hns__ (1hns -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (2 families) 
Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins) 
Protein DNA-binding domain of H1 protein, (H-NS) [47733] (1 species) Species Escherichia coli [TaxId:562] [47734] (2 PDB entries) 
Domain d1hns__: 1hns - [17895]
Details for d1hns__
PDB Entry: 1hns (more details)
PDB Description: h-ns (dna-binding domain)
SCOP Domain Sequences for d1hns__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hns__ a.55.1.1 (-) DNA-binding domain of H1 protein, (H-NS) {Escherichia coli}
aqrpakysyvdengetktwtgqgrtpavikkamdeqgkslddflikq
SCOP Domain Coordinates for d1hns__:
Click to download the PDB-style file with coordinates for d1hns__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hns__:
- d1hns__ first appeared (with stable ids) in SCOP 1.55
- d1hns__ appears in SCOP 1.59
- d1hns__ appears in the current release, SCOPe 2.08, called d1hnsa_
View in 3D