Lineage for d1hns__ (1hns -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4185Fold a.55: Prokaryotic DNA-bending protein [47728] (1 superfamily)
  4. 4186Superfamily a.55.1: Prokaryotic DNA-bending protein [47729] (1 family) (S)
  5. 4187Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins)
  6. 4188Protein DNA-binding domain of H1 protein, (H-NS) [47733] (1 species)
  7. 4189Species Escherichia coli [TaxId:562] [47734] (2 PDB entries)
  8. 4190Domain d1hns__: 1hns - [17895]

Details for d1hns__

PDB Entry: 1hns (more details)

PDB Description: h-ns (dna-binding domain)

SCOP Domain Sequences for d1hns__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hns__ a.55.1.1 (-) DNA-binding domain of H1 protein, (H-NS) {Escherichia coli}
aqrpakysyvdengetktwtgqgrtpavikkamdeqgkslddflikq

SCOP Domain Coordinates for d1hns__:

Click to download the PDB-style file with coordinates for d1hns__.
(The format of our PDB-style files is described here.)

Timeline for d1hns__: