SCOPe 2.06: Domain d3jzoa_: 3jzo A:

Lineage for d3jzoa_ (3jzo A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.0: automated matches [191556] (1 protein)
   not a true family

6. Protein automated matches [190960] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188578] (14 PDB entries)

8. Domain d3jzoa_: 3jzo A: [178931]
   automated match to d1ycqa_
   complexed with k

Details for d3jzoa_

PDB Entry: 3jzo, 1.8 Å

PDB Description: Human MDMX liganded with a 12mer peptide (pDI)

PDB Compounds: (A:) Protein Mdm4

SCOPe Domain Sequences for d3jzoa_:

Sequence; same for both SEQRES and ATOM records:

>d3jzoa_ a.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllg
ellgrqsfsvkdpsplydmlrknlvtl

Timeline for d3jzoa_:

• d3jzoa_ first appeared in SCOPe 2.01
  
• d3jzoa_ appears in SCOPe 2.05
  
• d3jzoa_ appears in SCOPe 2.07
  
• d3jzoa_ appears in the current release, SCOPe 2.08