Lineage for d3jtbd_ (3jtb D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 940170Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 940171Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 940172Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 940616Protein automated matches [190545] (4 species)
    not a true protein
  7. 940629Species Pseudomonas aeruginosa [TaxId:287] [187720] (5 PDB entries)
  8. 940635Domain d3jtbd_: 3jtb D: [178818]
    automated match to d1azna_
    complexed with cu

Details for d3jtbd_

PDB Entry: 3jtb (more details), 1.8 Å

PDB Description: cu(ii) n47s/f114n variant of pseudomonas aeruginosa azurin
PDB Compounds: (D:) Azurin

SCOPe Domain Sequences for d3jtbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jtbd_ b.6.1.1 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghswvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctnpghsal
mkgtltlk

SCOPe Domain Coordinates for d3jtbd_:

Click to download the PDB-style file with coordinates for d3jtbd_.
(The format of our PDB-style files is described here.)

Timeline for d3jtbd_: