SCOPe 2.08: Domain d3jstb_: 3jst B:

Lineage for d3jstb_ (3jst B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.1: PCD-like [55248] (2 families)
   has additional alpha helix at the N-terminus

5. Family d.74.1.0: automated matches [191598] (1 protein)
   not a true family

6. Protein automated matches [191088] (2 species)
   not a true protein

7. Species Brucella melitensis [TaxId:29459] [189050] (1 PDB entry)

8. Domain d3jstb_: 3jst B: [178792]
   automated match to d1dcha_
   complexed with edo

Details for d3jstb_

PDB Entry: 3jst, 2.1 Å

PDB Description: Crystal structure of transcriptional coactivator/pterin dehydratase from Brucella Melitensis

PDB Compounds: (B:) Putative pterin-4-alpha-carbinolamine dehydratase

SCOPe Domain Sequences for d3jstb_:

Sequence; same for both SEQRES and ATOM records:

>d3jstb_ d.74.1.0 (B:) automated matches {Brucella melitensis [TaxId: 29459]}
nrltesemnealraldgwqkvdgreaitrsfkfkdfstafgfmaqaalyaekldhhpewf
naynrvdvtlathsengvteldikmarkmnaiag

Timeline for d3jstb_:

• d3jstb_ first appeared in SCOPe 2.01
  
• d3jstb_ appears in SCOPe 2.07