![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.1: PCD-like [55248] (2 families) ![]() has additional alpha helix at the N-terminus |
![]() | Family d.74.1.0: automated matches [191598] (1 protein) not a true family |
![]() | Protein automated matches [191088] (1 species) not a true protein |
![]() | Species Brucella melitensis [TaxId:29459] [189050] (1 PDB entry) |
![]() | Domain d3jstb_: 3jst B: [178792] automated match to d1dcha_ complexed with edo |
PDB Entry: 3jst (more details), 2.1 Å
SCOPe Domain Sequences for d3jstb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jstb_ d.74.1.0 (B:) automated matches {Brucella melitensis [TaxId: 29459]} nrltesemnealraldgwqkvdgreaitrsfkfkdfstafgfmaqaalyaekldhhpewf naynrvdvtlathsengvteldikmarkmnaiag
Timeline for d3jstb_: