| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
| Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
| Protein Proteasome beta subunit (catalytic) [56252] (5 species) |
| Species Thermoplasma acidophilum [TaxId:2303] [56253] (5 PDB entries) |
| Domain d3jsel_: 3jse L: [178769] Other proteins in same PDB: d3jsea_, d3jseb_, d3jsec_, d3jsed_, d3jsee_, d3jsef_, d3jseg_, d3jseo_, d3jsep_, d3jseq_, d3jser_, d3jses_, d3jset_, d3jseu_ automated match to d1pma1_ |
PDB Entry: 3jse (more details), 2.9 Å
SCOPe Domain Sequences for d3jsel_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jsel_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil
Timeline for d3jsel_: