| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
| Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
| Protein automated matches [190144] (7 species) not a true protein |
| Species Thermoplasma acidophilum [TaxId:2303] [186869] (5 PDB entries) |
| Domain d3jseb_: 3jse B: [178759] Other proteins in same PDB: d3jseh_, d3jsei_, d3jsej_, d3jsek_, d3jsel_, d3jsem_, d3jsen_, d3jseo_, d3jsep_, d3jseq_, d3jser_, d3jses_, d3jset_, d3jseu_ automated match to d1pmaa_ |
PDB Entry: 3jse (more details), 2.9 Å
SCOPe Domain Sequences for d3jseb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jseb_ d.153.1.4 (B:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
Timeline for d3jseb_: