Lineage for d3jsej_ (3jse J:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222614Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1222615Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1222781Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1223291Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1223720Species Thermoplasma acidophilum [TaxId:2303] [56253] (5 PDB entries)
  8. 1223730Domain d3jsej_: 3jse J: [178767]
    Other proteins in same PDB: d3jsea_, d3jseb_, d3jsec_, d3jsed_, d3jsee_, d3jsef_, d3jseg_, d3jseo_, d3jsep_, d3jseq_, d3jser_, d3jses_, d3jset_, d3jseu_
    automated match to d1pma1_

Details for d3jsej_

PDB Entry: 3jse (more details), 2.9 Å

PDB Description: crystal structure of archaeal 20s proteasome in complex with mutated p26 activator
PDB Compounds: (J:) Proteasome subunit beta

SCOPe Domain Sequences for d3jsej_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jsej_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil

SCOPe Domain Coordinates for d3jsej_:

Click to download the PDB-style file with coordinates for d3jsej_.
(The format of our PDB-style files is described here.)

Timeline for d3jsej_: