Lineage for d1pesd_ (1pes D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493085Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
    core: 4 helices; bundle
  4. 1493086Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) (S)
    homotetramer
  5. 1493087Family a.53.1.1: p53 tetramerization domain [47720] (1 protein)
  6. 1493088Protein p53 tetramerization domain [47721] (1 species)
  7. 1493089Species Human (Homo sapiens) [TaxId:9606] [47722] (14 PDB entries)
  8. 1493127Domain d1pesd_: 1pes D: [17862]

Details for d1pesd_

PDB Entry: 1pes (more details)

PDB Description: nmr solution structure of the tetrameric minimum transforming domain of p53
PDB Compounds: (D:) tumor suppressor p53

SCOPe Domain Sequences for d1pesd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pesd_ a.53.1.1 (D:) p53 tetramerization domain {Human (Homo sapiens) [TaxId: 9606]}
geyftlqirgrerfemfrelnealelkdaqa

SCOPe Domain Coordinates for d1pesd_:

Click to download the PDB-style file with coordinates for d1pesd_.
(The format of our PDB-style files is described here.)

Timeline for d1pesd_: