SCOPe 2.03: Domain d3iqva_: 3iqv A:

Lineage for d3iqva_ (3iqv A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein automated matches [190238] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187008] (37 PDB entries)

8. Domain d3iqva_: 3iqv A: [178565]
   automated match to d1qjaa_
   complexed with cl, fsc, mg

Details for d3iqva_

PDB Entry: 3iqv, 1.2 Å

PDB Description: crystal structure of human 14-3-3 sigma in complex with raf1 peptide (6mer) and stabilisator fusicoccin

PDB Compounds: (A:) 14-3-3 protein sigma

SCOPe Domain Sequences for d3iqva_:

Sequence; same for both SEQRES and ATOM records:

>d3iqva_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglaln
fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

Timeline for d3iqva_:

• d3iqva_ first appeared in SCOPe 2.01
  
• d3iqva_ appears in SCOPe 2.02
  
• d3iqva_ appears in SCOPe 2.04
  
• d3iqva_ appears in the current release, SCOPe 2.08, called d3iqva1