Lineage for d3iqva1 (3iqv A:1-231)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726458Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2726459Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2726519Protein automated matches [190238] (11 species)
    not a true protein
  7. 2726535Species Human (Homo sapiens) [TaxId:9606] [187008] (56 PDB entries)
  8. 2726542Domain d3iqva1: 3iqv A:1-231 [178565]
    Other proteins in same PDB: d3iqva2
    automated match to d1qjaa_
    complexed with cl, fsc, mg

Details for d3iqva1

PDB Entry: 3iqv (more details), 1.2 Å

PDB Description: crystal structure of human 14-3-3 sigma in complex with raf1 peptide (6mer) and stabilisator fusicoccin
PDB Compounds: (A:) 14-3-3 protein sigma

SCOPe Domain Sequences for d3iqva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iqva1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

SCOPe Domain Coordinates for d3iqva1:

Click to download the PDB-style file with coordinates for d3iqva1.
(The format of our PDB-style files is described here.)

Timeline for d3iqva1: