Lineage for d3imib_ (3imi B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536878Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2536879Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2536880Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2536979Protein automated matches [191082] (3 species)
    not a true protein
  7. 2536980Species Bacillus anthracis [TaxId:261594] [189022] (1 PDB entry)
  8. 2536982Domain d3imib_: 3imi B: [178409]
    automated match to d1y23b_
    complexed with so4, zn

Details for d3imib_

PDB Entry: 3imi (more details), 2.01 Å

PDB Description: 2.01 angstrom resolution crystal structure of a hit family protein from bacillus anthracis str. 'ames ancestor'
PDB Compounds: (B:) HIT family protein

SCOPe Domain Sequences for d3imib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3imib_ d.13.1.1 (B:) automated matches {Bacillus anthracis [TaxId: 261594]}
htadncifckiidgqilcskvyedehvlafldisqvtkghtlvipkvhkqdifaltpeia
shifsvvpkianaikaefnpvgfnllnnngekagqtvfhfhlhliprygendgfgavwks
hqneytmenlqniastiansvk

SCOPe Domain Coordinates for d3imib_:

Click to download the PDB-style file with coordinates for d3imib_.
(The format of our PDB-style files is described here.)

Timeline for d3imib_: