Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (6 families) |
Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins) Pfam PF01230 topologically similar to the N-terminal domain of protein kinases |
Protein automated matches [191082] (3 species) not a true protein |
Species Bacillus anthracis [TaxId:261594] [189022] (1 PDB entry) |
Domain d3imib_: 3imi B: [178409] automated match to d1y23b_ complexed with so4, zn |
PDB Entry: 3imi (more details), 2.01 Å
SCOPe Domain Sequences for d3imib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3imib_ d.13.1.1 (B:) automated matches {Bacillus anthracis [TaxId: 261594]} htadncifckiidgqilcskvyedehvlafldisqvtkghtlvipkvhkqdifaltpeia shifsvvpkianaikaefnpvgfnllnnngekagqtvfhfhlhliprygendgfgavwks hqneytmenlqniastiansvk
Timeline for d3imib_: