Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.5: IpsF-like [69765] (2 families) forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.5.1: IpsF-like [69766] (3 proteins) |
Protein automated matches [190985] (3 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:28450] [189021] (2 PDB entries) |
Domain d3ikfa_: 3ikf A: [178372] automated match to d1jn1a_ complexed with 717, act, cl, k, zn |
PDB Entry: 3ikf (more details), 2.07 Å
SCOPe Domain Sequences for d3ikfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ikfa_ d.79.5.1 (A:) automated matches {Burkholderia pseudomallei [TaxId: 28450]} mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig rhfsdtdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaa dldlpldrvnvkaktneklgylgrgegieaqaaalvvr
Timeline for d3ikfa_: