Lineage for d3ikab_ (3ika B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543502Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
    PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2543503Species Human (Homo sapiens) [TaxId:9606] [82796] (103 PDB entries)
    Uniprot P00533 702-1018
  8. 2543565Domain d3ikab_: 3ika B: [178368]
    automated match to d1m14a_
    complexed with 0un; mutant

Details for d3ikab_

PDB Entry: 3ika (more details), 2.9 Å

PDB Description: Crystal Structure of EGFR 696-1022 T790M Mutant Covalently Binding to WZ4002
PDB Compounds: (B:) Epidermal growth factor receptor

SCOPe Domain Sequences for d3ikab_:

Sequence, based on SEQRES records: (download)

>d3ikab_ d.144.1.7 (B:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkan
keildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqylln
wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkv
pikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqp
pictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsn
fyralmdeedmddvvdadeyl

Sequence, based on observed residues (ATOM records): (download)

>d3ikab_ d.144.1.7 (B:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkan
keildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqylln
wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglaklaeekeyhaeggkvpi
kwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppi
ctidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermtdsnfyralmd
eevvdadeyl

SCOPe Domain Coordinates for d3ikab_:

Click to download the PDB-style file with coordinates for d3ikab_.
(The format of our PDB-style files is described here.)

Timeline for d3ikab_: