SCOPe 2.07: Domain d3ifta1: 3ift A:2-134

Lineage for d3ifta1 (3ift A:2-134)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.0: automated matches [191593] (1 protein)
   not a true family

6. Protein automated matches [191080] (7 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189016] (1 PDB entry)

8. Domain d3ifta1: 3ift A:2-134 [178301]
   Other proteins in same PDB: d3ifta2
   automated match to d1onla_

Details for d3ifta1

PDB Entry: 3ift, 2 Å

PDB Description: crystal structure of glycine cleavage system protein h from mycobacterium tuberculosis, using x-rays from the compact light source.

PDB Compounds: (A:) glycine cleavage system H protein

SCOPe Domain Sequences for d3ifta1:

Sequence; same for both SEQRES and ATOM records:

>d3ifta1 b.84.1.0 (A:2-134) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
sdipsdlhytaehewirrsgddtvrvgitdyaqsalgdvvfvqlpvigtavtagetfgev
estksvsdlyapisgkvsevnsdldgtpqlvnsdpygagwlldiqvdssdvaalesaltt
lldaeayrgtlte

Timeline for d3ifta1:

• d3ifta1 first appeared in SCOPe 2.01, called d3ifta_
  
• d3ifta1 appears in SCOPe 2.06
  
• d3ifta1 appears in the current release, SCOPe 2.08