SCOPe 2.05: Domain d3ibob_: 3ibo B:

Lineage for d3ibob_ (3ibo B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (87 PDB entries)
   Uniprot P00282

8. Domain d3ibob_: 3ibo B: [178225]
   automated match to d1i53a_
   complexed with cu, rep

Details for d3ibob_

PDB Entry: 3ibo, 1.45 Å

PDB Description: pseudomonas aeruginosa e2q/h83q/t126h-azurin re(phen)(co)3

PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d3ibob_:

Sequence; same for both SEQRES and ATOM records:

>d3ibob_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviaqtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtlhlk

Timeline for d3ibob_:

• d3ibob_ first appeared in SCOPe 2.01
  
• d3ibob_ appears in SCOPe 2.04
  
• d3ibob_ appears in SCOPe 2.06
  
• d3ibob_ appears in the current release, SCOPe 2.08