Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein Azurin [49530] (6 species) |
Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries) Uniprot P00282 |
Domain d3iboa_: 3ibo A: [178224] automated match to d1i53a_ complexed with cu, rep |
PDB Entry: 3ibo (more details), 1.45 Å
SCOPe Domain Sequences for d3iboa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iboa_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv tdgmasgldkdylkpddsrviaqtkligsgekdsvtfdvsklkegeqymffctfpghsal mkgtlhlk
Timeline for d3iboa_: