PDB entry 3ibo

View 3ibo on RCSB PDB site
Description: Pseudomonas aeruginosa E2Q/H83Q/T126H-azurin RE(PHEN)(CO)3
Class: transport protein
Keywords: blue copper, electron transfer, protein dynamics, rhenium, vibrational spectroscopy solvation, Copper, Disulfide bond, Electron transport, Metal-binding, Periplasm, Transport, TRANSPORT PROTEIN
Deposited on 2009-07-16, released 2009-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-12-08, with a file datestamp of 2009-12-04.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.206
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (1)
      • engineered (82)
      • engineered (125)
    Domains in SCOPe 2.07: d3iboa_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (1)
      • engineered (82)
      • engineered (125)
    Domains in SCOPe 2.07: d3ibob_
  • Chain 'C':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (1)
      • engineered (82)
      • engineered (125)
    Domains in SCOPe 2.07: d3iboc_
  • Chain 'D':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (1)
      • engineered (82)
      • engineered (125)
    Domains in SCOPe 2.07: d3ibod_
  • Heterogens: CU, REP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3iboA (A:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviaqtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtlhlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3iboB (B:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviaqtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtlhlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3iboC (C:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviaqtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtlhlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3iboD (D:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviaqtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtlhlk