Lineage for d3iaia_ (3iai A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1136597Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1136598Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1137116Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 1137117Protein automated matches [191011] (2 species)
    not a true protein
  7. 1137118Species Human (Homo sapiens) [TaxId:9606] [188766] (5 PDB entries)
  8. 1137124Domain d3iaia_: 3iai A: [178211]
    automated match to d1rj5a_
    complexed with azm, gol, po4, trs, zn

Details for d3iaia_

PDB Entry: 3iai (more details), 2.2 Å

PDB Description: crystal structure of the catalytic domain of the tumor-associated human carbonic anhydrase ix
PDB Compounds: (A:) Carbonic anhydrase 9

SCOPe Domain Sequences for d3iaia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iaia_ b.74.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpdqshwryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelr
lrnnghsvqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvh
lstafarvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldis
allpsdfsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqln
fratqplngrvieasfp

SCOPe Domain Coordinates for d3iaia_:

Click to download the PDB-style file with coordinates for d3iaia_.
(The format of our PDB-style files is described here.)

Timeline for d3iaia_: