Class b: All beta proteins [48724] (174 folds) |
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) |
Family b.11.1.0: automated matches [191607] (1 protein) not a true family |
Protein automated matches [191109] (6 species) not a true protein |
Species Clostridium beijerinckii [TaxId:290402] [189152] (6 PDB entries) |
Domain d3i9hb_: 3i9h B: [178167] automated match to d1npsa_ complexed with ca |
PDB Entry: 3i9h (more details), 2 Å
SCOPe Domain Sequences for d3i9hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i9hb_ b.11.1.0 (B:) automated matches {Clostridium beijerinckii [TaxId: 290402]} kavtfyedinyggasvslqpgnytlsqlntakipndwmtslkvpsgwtvdvyendnftgt kwtytsdtpwvgndandkmtsvkiyst
Timeline for d3i9hb_: