Lineage for d3i98d_ (3i98 D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2400325Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2400326Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2400434Protein automated matches [191079] (5 species)
    not a true protein
  7. 2400461Species Thermococcus thioreducens [TaxId:277988] [189009] (8 PDB entries)
  8. 2400483Domain d3i98d_: 3i98 D: [178161]
    automated match to d1twla_
    complexed with ace, ca, mpd, mrd

Details for d3i98d_

PDB Entry: 3i98 (more details), 1.85 Å

PDB Description: x-ray crystallographic structure of inorganic pyrophosphatase at 298k from archaeon thermococcus thioreducens
PDB Compounds: (D:) Th-IPP

SCOPe Domain Sequences for d3i98d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i98d_ b.40.5.1 (D:) automated matches {Thermococcus thioreducens [TaxId: 277988]}
mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfg

SCOPe Domain Coordinates for d3i98d_:

Click to download the PDB-style file with coordinates for d3i98d_.
(The format of our PDB-style files is described here.)

Timeline for d3i98d_: