Lineage for d3i5je_ (3i5j E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2584614Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
    corner-like structure formed by two sheets and filled in with 2-3 helices
  4. 2584615Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) (S)
    duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold
  5. 2584616Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
    note: the solution structure determinations disagree in the relative orientations of two motifs
  6. 2584630Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species)
  7. 2584631Species Pseudomonas mendocina [TaxId:300] [64395] (18 PDB entries)
  8. 2584633Domain d3i5je_: 3i5j E: [178098]
    Other proteins in same PDB: d3i5ja_, d3i5jc_
    automated match to d1g10a_
    complexed with fe

Details for d3i5je_

PDB Entry: 3i5j (more details), 1.9 Å

PDB Description: Diferric Resting State Toluene 4-Monooxygenase HD complex
PDB Compounds: (E:) toluene-4-monooxygenase system protein d

SCOPe Domain Sequences for d3i5je_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i5je_ d.137.1.1 (E:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]}
stladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltr
ktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm

SCOPe Domain Coordinates for d3i5je_:

Click to download the PDB-style file with coordinates for d3i5je_.
(The format of our PDB-style files is described here.)

Timeline for d3i5je_: