| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) ![]() can be classified as disulfide-rich |
| Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins) |
| Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species) |
| Species Wheat (Triticum aestivum), L. seeds [TaxId:4565] [47704] (3 PDB entries) |
| Domain d1cz2a_: 1cz2 A: [17809] complexed with prostaglandin b2 complexed with e2p |
PDB Entry: 1cz2 (more details)
SCOPe Domain Sequences for d1cz2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cz2a_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Wheat (Triticum aestivum), L. seeds [TaxId: 4565]}
idcghvdslvrpclsyvqggpgpsgqccdgvknlhnqarsqsdrqsacnclkgiargihn
lnednarsippkcgvnlpytislnidcsrv
Timeline for d1cz2a_: