SCOPe 2.08: Domain d1cz2a_: 1cz2 A:

Lineage for d1cz2a_ (1cz2 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)

6. Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species)

7. Species Wheat (Triticum aestivum), L. seeds [TaxId:4565] [47704] (3 PDB entries)

8. Domain d1cz2a_: 1cz2 A: [17809]
   complexed with prostaglandin b2
   complexed with e2p

Details for d1cz2a_

PDB Entry: 1cz2

PDB Description: solution structure of wheat ns-ltp complexed with prostaglandin b2.

PDB Compounds: (A:) nonspecific lipid transfer protein

SCOPe Domain Sequences for d1cz2a_:

Sequence; same for both SEQRES and ATOM records:

>d1cz2a_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Wheat (Triticum aestivum), L. seeds [TaxId: 4565]}
idcghvdslvrpclsyvqggpgpsgqccdgvknlhnqarsqsdrqsacnclkgiargihn
lnednarsippkcgvnlpytislnidcsrv

Timeline for d1cz2a_:

• d1cz2a_ first appeared (with stable ids) in SCOP 1.55
  
• d1cz2a_ appears in SCOPe 2.07