Lineage for d3hznf_ (3hzn F:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211817Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 1211818Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 1211819Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 1211904Protein automated matches [190153] (2 species)
    not a true protein
  7. 1211914Species Salmonella enterica [TaxId:99287] [188996] (1 PDB entry)
  8. 1211920Domain d3hznf_: 3hzn F: [177968]
    automated match to d1ds7a_
    complexed with act, cl, flc, mli, na, sin, tla

Details for d3hznf_

PDB Entry: 3hzn (more details), 2.4 Å

PDB Description: structure of the salmonella typhimurium nfnb dihydropteridine reductase
PDB Compounds: (F:) oxygen-insensitive nad(p)h nitroreductase

SCOPe Domain Sequences for d3hznf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hznf_ d.90.1.1 (F:) automated matches {Salmonella enterica [TaxId: 99287]}
namdivsvalqrystkafdpskkltaeeadkiktllqyspsstnsqpwhfivasteegka
rvaksaagnytfnerkmldashvvvfcaktamddawlervvdqedadgrfatpeakaand
kgrrffadmhrvslkddhqwmakqvylnvgnfllgvaamgldavpiegfdaevldaefgl
kekgytslvvvpvghhsvedfnaglpksrlplettltev

SCOPe Domain Coordinates for d3hznf_:

Click to download the PDB-style file with coordinates for d3hznf_.
(The format of our PDB-style files is described here.)

Timeline for d3hznf_: