Lineage for d3hzbh_ (3hzb H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773616Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2773617Protein automated matches [191109] (11 species)
    not a true protein
  7. 2773653Species Flavobacterium johnsoniae [TaxId:376686] [189150] (1 PDB entry)
  8. 2773661Domain d3hzbh_: 3hzb H: [177959]
    automated match to d1npsa_
    complexed with ca

Details for d3hzbh_

PDB Entry: 3hzb (more details), 1.74 Å

PDB Description: crystal structure of a betagamma-crystallin domain from flavobacterium johnsoniae
PDB Compounds: (H:) Carbohydrate binding protein

SCOPe Domain Sequences for d3hzbh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hzbh_ b.11.1.0 (H:) automated matches {Flavobacterium johnsoniae [TaxId: 376686]}
dvitvykdcnytgfsggltigdynlarlnslgvlnddisslritqgyqailyqddnfgga
stvinsdnsclnttwndkvssirvian

SCOPe Domain Coordinates for d3hzbh_:

Click to download the PDB-style file with coordinates for d3hzbh_.
(The format of our PDB-style files is described here.)

Timeline for d3hzbh_: