PDB entry 3hzb

View 3hzb on RCSB PDB site
Description: Crystal structure of a betagamma-crystallin domain from Flavobacterium johnsoniae
Class: metal binding protein
Keywords: calcium-bound betagamma-crystallin, METAL BINDING PROTEIN
Deposited on 2009-06-23, released 2009-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbohydrate binding protein
    Species: Flavobacterium johnsoniae [TaxId:376686]
    Gene: 5093804
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hzba_
  • Chain 'B':
    Compound: Carbohydrate binding protein
    Species: Flavobacterium johnsoniae [TaxId:376686]
    Gene: 5093804
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hzbb_
  • Chain 'C':
    Compound: Carbohydrate binding protein
    Species: Flavobacterium johnsoniae [TaxId:376686]
    Gene: 5093804
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hzbc_
  • Chain 'D':
    Compound: Carbohydrate binding protein
    Species: Flavobacterium johnsoniae [TaxId:376686]
    Gene: 5093804
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hzbd_
  • Chain 'E':
    Compound: Carbohydrate binding protein
    Species: Flavobacterium johnsoniae [TaxId:376686]
    Gene: 5093804
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hzbe_
  • Chain 'F':
    Compound: Carbohydrate binding protein
    Species: Flavobacterium johnsoniae [TaxId:376686]
    Gene: 5093804
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hzbf_
  • Chain 'G':
    Compound: Carbohydrate binding protein
    Species: Flavobacterium johnsoniae [TaxId:376686]
    Gene: 5093804
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hzbg_
  • Chain 'H':
    Compound: Carbohydrate binding protein
    Species: Flavobacterium johnsoniae [TaxId:376686]
    Gene: 5093804
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hzbh_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hzbA (A:)
    dvitvykdcnytgfsggltigdynlarlnslgvlnddisslritqgyqailyqddnfgga
    stvinsdnsclnttwndkvssirviangtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hzbA (A:)
    dvitvykdcnytgfsggltigdynlarlnslgvlnddisslritqgyqailyqddnfgga
    stvinsdnsclnttwndkvssirvia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hzbB (B:)
    dvitvykdcnytgfsggltigdynlarlnslgvlnddisslritqgyqailyqddnfgga
    stvinsdnsclnttwndkvssirviangtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hzbB (B:)
    dvitvykdcnytgfsggltigdynlarlnslgvlnddisslritqgyqailyqddnfgga
    stvinsdnsclnttwndkvssirvian
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hzbC (C:)
    dvitvykdcnytgfsggltigdynlarlnslgvlnddisslritqgyqailyqddnfgga
    stvinsdnsclnttwndkvssirviangtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hzbC (C:)
    dvitvykdcnytgfsggltigdynlarlnslgvlnddisslritqgyqailyqddnfgga
    stvinsdnsclnttwndkvssirviang
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hzbD (D:)
    dvitvykdcnytgfsggltigdynlarlnslgvlnddisslritqgyqailyqddnfgga
    stvinsdnsclnttwndkvssirviangtt
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hzbE (E:)
    dvitvykdcnytgfsggltigdynlarlnslgvlnddisslritqgyqailyqddnfgga
    stvinsdnsclnttwndkvssirviangtt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3hzbF (F:)
    dvitvykdcnytgfsggltigdynlarlnslgvlnddisslritqgyqailyqddnfgga
    stvinsdnsclnttwndkvssirviangtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hzbF (F:)
    dvitvykdcnytgfsggltigdynlarlnslgvlnddisslritqgyqailyqddnfgga
    stvinsdnsclnttwndkvssirviang
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3hzbG (G:)
    dvitvykdcnytgfsggltigdynlarlnslgvlnddisslritqgyqailyqddnfgga
    stvinsdnsclnttwndkvssirviangtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hzbG (G:)
    dvitvykdcnytgfsggltigdynlarlnslgvlnddisslritqgyqailyqddnfgga
    stvinsdnsclnttwndkvssirvian
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3hzbH (H:)
    dvitvykdcnytgfsggltigdynlarlnslgvlnddisslritqgyqailyqddnfgga
    stvinsdnsclnttwndkvssirviangtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hzbH (H:)
    dvitvykdcnytgfsggltigdynlarlnslgvlnddisslritqgyqailyqddnfgga
    stvinsdnsclnttwndkvssirvian