Lineage for d3hzbf_ (3hzb F:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304495Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 1304496Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 1304607Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 1304608Protein automated matches [191109] (6 species)
    not a true protein
  7. 1304640Species Flavobacterium johnsoniae [TaxId:376686] [189150] (1 PDB entry)
  8. 1304646Domain d3hzbf_: 3hzb F: [177957]
    automated match to d1npsa_
    complexed with ca

Details for d3hzbf_

PDB Entry: 3hzb (more details), 1.74 Å

PDB Description: crystal structure of a betagamma-crystallin domain from flavobacterium johnsoniae
PDB Compounds: (F:) Carbohydrate binding protein

SCOPe Domain Sequences for d3hzbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hzbf_ b.11.1.0 (F:) automated matches {Flavobacterium johnsoniae [TaxId: 376686]}
dvitvykdcnytgfsggltigdynlarlnslgvlnddisslritqgyqailyqddnfgga
stvinsdnsclnttwndkvssirviang

SCOPe Domain Coordinates for d3hzbf_:

Click to download the PDB-style file with coordinates for d3hzbf_.
(The format of our PDB-style files is described here.)

Timeline for d3hzbf_: