Lineage for d3hzbc_ (3hzb C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383151Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2383152Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2383303Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2383304Protein automated matches [191109] (11 species)
    not a true protein
  7. 2383340Species Flavobacterium johnsoniae [TaxId:376686] [189150] (1 PDB entry)
  8. 2383343Domain d3hzbc_: 3hzb C: [177954]
    automated match to d1npsa_
    complexed with ca

Details for d3hzbc_

PDB Entry: 3hzb (more details), 1.74 Å

PDB Description: crystal structure of a betagamma-crystallin domain from flavobacterium johnsoniae
PDB Compounds: (C:) Carbohydrate binding protein

SCOPe Domain Sequences for d3hzbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hzbc_ b.11.1.0 (C:) automated matches {Flavobacterium johnsoniae [TaxId: 376686]}
dvitvykdcnytgfsggltigdynlarlnslgvlnddisslritqgyqailyqddnfgga
stvinsdnsclnttwndkvssirviang

SCOPe Domain Coordinates for d3hzbc_:

Click to download the PDB-style file with coordinates for d3hzbc_.
(The format of our PDB-style files is described here.)

Timeline for d3hzbc_: