SCOPe 2.01: Domain d3hu8a_: 3hu8 A:

Lineage for d3hu8a_ (3hu8 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (3 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (520 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d3hu8a_: 3hu8 A: [177840]
   automated match to d1l19a_
   complexed with 261, po4

Details for d3hu8a_

PDB Entry: 3hu8, 1.8 Å

PDB Description: 2-ethoxyphenol in complex with t4 lysozyme l99a/m102q

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d3hu8a_:

Sequence; same for both SEQRES and ATOM records:

>d3hu8a_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspdlnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainqvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpdrakrvittfrtgtwdayk

Timeline for d3hu8a_:

• d3hu8a_ is new in SCOPe 2.01-stable
  
• d3hu8a_ appears in SCOPe 2.02
  
• d3hu8a_ appears in the current release, SCOPe 2.08