![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily) duplication: consists of two similar beta-alpha-beta(4) motifs |
![]() | Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families) ![]() characteristic metal ion (zinc)-binding motif in the putative active site |
![]() | Family d.290.1.0: automated matches [191426] (1 protein) not a true family |
![]() | Protein automated matches [190613] (9 species) not a true protein |
![]() | Species Bacteroides thetaiotaomicron [TaxId:226186] [188947] (1 PDB entry) |
![]() | Domain d3htna_: 3htn A: [177832] automated match to d2h6la1 complexed with 1pe, fe, ni, so4 |
PDB Entry: 3htn (more details), 1.5 Å
SCOPe Domain Sequences for d3htna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3htna_ d.290.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} nmysykkignkyivsinnhteivkalnafckekgilsgsingigaigeltlrffnpktka yddktfreqmeisnltgnissmneqvylhlhitvgrsdysalaghllsaiqngagefvve dyserisrtynpdlglniydfer
Timeline for d3htna_: