SCOPe 2.07: Domain d3hokb_: 3hok B:

Lineage for d3hokb_ (3hok B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (26 PDB entries)
   Uniprot P09601

8. Domain d3hokb_: 3hok B: [177736]
   automated match to d1ni6c_
   complexed with hem, q80

Details for d3hokb_

PDB Entry: 3hok, 2.19 Å

PDB Description: X-ray Crystal Structure of Human Heme Oxygenase-1 with (2R, 4S)-2-[2-(4-Chlorophenyl)ethyl]-2-[(1H-imidazol-1-yl)methyl]-4[((5-trifluoromethylpyridin-2-yl)thio)methyl]-1,3-dioxolane: A Novel, Inducible Binding Mode

PDB Compounds: (B:) Heme oxygenase 1

SCOPe Domain Sequences for d3hokb_:

Sequence; same for both SEQRES and ATOM records:

>d3hokb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
mpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiern
kespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepel
lvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmns
lemtpavrqrvieeaktafllniqlfeelqellth

Timeline for d3hokb_:

• d3hokb_ first appeared in SCOPe 2.01
  
• d3hokb_ appears in SCOPe 2.06
  
• d3hokb_ appears in the current release, SCOPe 2.08