SCOPe 2.03: Domain d3hmsa_: 3hms A:

Lineage for d3hmsa_ (3hms A:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
   alpha+beta fold with two crossing loops

4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families)
   the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern

5. Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
   automatically mapped to Pfam PF00024

6. Protein Hepatocyte growth factor [57416] (1 species)
   heparin-binding domain

7. Species Human (Homo sapiens) [TaxId:9606] [57417] (9 PDB entries)

8. Domain d3hmsa_: 3hms A: [177701]
   automated match to d2hgfa_
   complexed with so4

Details for d3hmsa_

PDB Entry: 3hms, 1.7 Å

PDB Description: Crystal Crystal structure of the N-terminal fragment (28-126) of the human hepatocyte growth factor/scatter factor, orthorhombic crystal form

PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d3hmsa_:

Sequence; same for both SEQRES and ATOM records:

>d3hmsa_ g.10.1.1 (A:) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
rntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkq
clwfpfnsmssgvkkefghefdlyenkdyir

Timeline for d3hmsa_:

• d3hmsa_ first appeared in SCOPe 2.01
  
• d3hmsa_ appears in SCOPe 2.02
  
• d3hmsa_ appears in SCOPe 2.04
  
• d3hmsa_ appears in the current release, SCOPe 2.08