PDB entry 3hms

View 3hms on RCSB PDB site
Description: Crystal Crystal structure of the N-terminal fragment (28-126) of the human hepatocyte growth factor/scatter factor, orthorhombic crystal form
Class: hormone
Keywords: HGF/SF, hormone/growth factor, Disulfide bond, Glycoprotein, Growth factor, Kringle, Pyrrolidone carboxylic acid, Serine protease homolog, HORMONE
Deposited on 2009-05-29, released 2010-06-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.202
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hepatocyte growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: HGF, HPTA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3hmsa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3hmsA (A:)
gsyaegqrkrrntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftck
afvfdkarkqclwfpfnsmssgvkkefghefdlyenkdyir

    Sequence, based on observed residues (ATOM records): (download) 
    >3hmsA (A:)
rntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkq
clwfpfnsmssgvkkefghefdlyenkdyir