Lineage for d3hk9c_ (3hk9 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2442004Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2442420Family c.1.9.8: Uronate isomerase-like [75082] (2 proteins)
    contains all-alpha subdomain inserted after the first strand
  6. 2442421Protein Uncharacterized protein BH0493 [159395] (1 species)
  7. 2442422Species Bacillus halodurans [TaxId:86665] [159396] (9 PDB entries)
    Uniprot Q9KFI6 1-423
  8. 2442452Domain d3hk9c_: 3hk9 C: [177640]
    automated match to d2pnka1
    complexed with cl, co3, rel, zn

Details for d3hk9c_

PDB Entry: 3hk9 (more details), 2.1 Å

PDB Description: Crystal structure of uronate isomerase from Bacillus halodurans complexed with zinc and D-Glucuronate
PDB Compounds: (C:) uronate isomerase

SCOPe Domain Sequences for d3hk9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hk9c_ c.1.9.8 (C:) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]}
sinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtdv
sieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfak
ktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeqt
khrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgriir
dcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtml
srenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvleq
liykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgr

SCOPe Domain Coordinates for d3hk9c_:

Click to download the PDB-style file with coordinates for d3hk9c_.
(The format of our PDB-style files is described here.)

Timeline for d3hk9c_: