Lineage for d3hjnb_ (3hjn B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 990511Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 990512Protein automated matches [190123] (20 species)
    not a true protein
  7. 990639Species Thermotoga maritima [TaxId:243274] [188915] (1 PDB entry)
  8. 990641Domain d3hjnb_: 3hjn B: [177614]
    automated match to d4tmka_
    complexed with adp, mg, tyd

Details for d3hjnb_

PDB Entry: 3hjn (more details), 2.1 Å

PDB Description: Crystal structure of thymidylate kinase in complex with dTDP and ADP from Thermotoga maritima
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d3hjnb_:

Sequence, based on SEQRES records: (download)

>d3hjnb_ c.37.1.0 (B:) automated matches {Thermotoga maritima [TaxId: 243274]}
mfitfegidgsgkstqiqllaqylekrgkkvilkrepggtetgekirkilleeevtpkae
lflflasrnllvteikqylsegyavlldrytdssvayqgfgrnlgkeiveelndfatdgl
ipdltfyidvdvetalkrkgelnrfekreflervregylvlarehperivvldgkrsiee
ihrdvvre

Sequence, based on observed residues (ATOM records): (download)

>d3hjnb_ c.37.1.0 (B:) automated matches {Thermotoga maritima [TaxId: 243274]}
mfitfegidgsgkstqiqllaqylekrgkkvilkrepggtetgekirkilleeevtpkae
lflflasrnllvteikqylsegyavlldrytdssvayqgfgrnlgkeiveelndfatdgl
ipdltfyidvdvetalkrnrfekreflervregylvlarehperivvldgkrsieeihrd
vvre

SCOPe Domain Coordinates for d3hjnb_:

Click to download the PDB-style file with coordinates for d3hjnb_.
(The format of our PDB-style files is described here.)

Timeline for d3hjnb_: