SCOPe 2.07: Domain d3hjjb_: 3hjj B:

Lineage for d3hjjb_ (3hjj B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (35 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188916] (2 PDB entries)

8. Domain d3hjjb_: 3hjj B: [177611]
   Other proteins in same PDB: d3hjja2
   automated match to d1ocxa_
   complexed with acy, gol, so4

Details for d3hjjb_

PDB Entry: 3hjj, 2.15 Å

PDB Description: crystal structure of maltose o-acetyltransferase from bacillus anthracis

PDB Compounds: (B:) maltose o-acetyltransferase

SCOPe Domain Sequences for d3hjjb_:

Sequence; same for both SEQRES and ATOM records:

>d3hjjb_ b.81.1.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mktekdkmlagemyiaddeelvadrveakrltrlyneavetgderrftllnqllgssadg
kaqinpdfrcdygynihvgksffanfncvildvcevrigdhcmfapgvhiytathplhpv
ernsgkeygkpvkignnvwvgggaiinpgvsigdnaviasgavvtkdvpnnvvvggnpak
viktiee

Timeline for d3hjjb_:

• d3hjjb_ first appeared in SCOPe 2.01
  
• d3hjjb_ appears in SCOPe 2.06
  
• d3hjjb_ appears in the current release, SCOPe 2.08