SCOPe 2.01: Domain d3hioa_: 3hio A:

Lineage for d3hioa_ (3hio A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein Ricin A-chain [56389] (1 species)

7. Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (28 PDB entries)
   Uniprot P06750 28-286

8. Domain d3hioa_: 3hio A: [177607]
   automated match to d1br6a_
   complexed with c2x, so4

Details for d3hioa_

PDB Entry: 3hio, 2 Å

PDB Description: crystal structure of ricin a-chain in complex with the cyclic tetranucleotide inhibitor, a transition state analogue

PDB Compounds: (A:) ricin

SCOPe Domain Sequences for d3hioa_:

Sequence; same for both SEQRES and ATOM records:

>d3hioa_ d.165.1.1 (A:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
rleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyi
egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd
vsilipiialmvyrcappp

Timeline for d3hioa_:

• d3hioa_ is new in SCOPe 2.01-stable
  
• d3hioa_ appears in SCOPe 2.02
  
• d3hioa_ appears in the current release, SCOPe 2.08