Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
Protein automated matches [190116] (28 species) not a true protein |
Species Halomonas elongata [TaxId:2746] [189250] (1 PDB entry) |
Domain d3hgmd_: 3hgm D: [177550] automated match to d1mjha_ complexed with atp, mg |
PDB Entry: 3hgm (more details), 1.9 Å
SCOPe Domain Sequences for d3hgmd_:
Sequence, based on SEQRES records: (download)
>d3hgmd_ c.26.2.0 (D:) automated matches {Halomonas elongata [TaxId: 2746]} mfnrimvpvdgskgavkalekgvglqqltgaelyilcvfkhhslleaslsmarpeqldip ddalkdyateiavqaktratelgvpadkvrafvkggrpsrtivrfarkrecdlvvigaqg tngdkslllgsvaqrvagsahcpvlvv
>d3hgmd_ c.26.2.0 (D:) automated matches {Halomonas elongata [TaxId: 2746]} mfnrimvpvdgskgavkalekgvglqqltgaelyilcvfkhaslsmarpqldipddalkd yateiavqaktratelgvpadkvrafvkggrpsrtivrfarkrecdlvvigaqgtngdks lllgsvaqrvagsahcpvlvv
Timeline for d3hgmd_: