SCOPe 2.08: Domain d3hgmd_: 3hgm D:

Lineage for d3hgmd_ (3hgm D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (28 species)
   not a true protein

7. Species Halomonas elongata [TaxId:2746] [189250] (1 PDB entry)

8. Domain d3hgmd_: 3hgm D: [177550]
   automated match to d1mjha_
   complexed with atp, mg

Details for d3hgmd_

PDB Entry: 3hgm, 1.9 Å

PDB Description: Universal Stress Protein TeaD from the TRAP transporter TeaABC of Halomonas elongata

PDB Compounds: (D:) Universal Stress Protein TeaD

SCOPe Domain Sequences for d3hgmd_:

Sequence, based on SEQRES records:

>d3hgmd_ c.26.2.0 (D:) automated matches {Halomonas elongata [TaxId: 2746]}
mfnrimvpvdgskgavkalekgvglqqltgaelyilcvfkhhslleaslsmarpeqldip
ddalkdyateiavqaktratelgvpadkvrafvkggrpsrtivrfarkrecdlvvigaqg
tngdkslllgsvaqrvagsahcpvlvv

Sequence, based on observed residues (ATOM records):

>d3hgmd_ c.26.2.0 (D:) automated matches {Halomonas elongata [TaxId: 2746]}
mfnrimvpvdgskgavkalekgvglqqltgaelyilcvfkhaslsmarpqldipddalkd
yateiavqaktratelgvpadkvrafvkggrpsrtivrfarkrecdlvvigaqgtngdks
lllgsvaqrvagsahcpvlvv

Timeline for d3hgmd_:

• d3hgmd_ first appeared in SCOPe 2.01
  
• d3hgmd_ appears in SCOPe 2.07