| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
| Protein automated matches [190116] (28 species) not a true protein |
| Species Halomonas elongata [TaxId:2746] [189250] (1 PDB entry) |
| Domain d3hgmc_: 3hgm C: [177549] automated match to d1mjha_ complexed with atp, mg |
PDB Entry: 3hgm (more details), 1.9 Å
SCOPe Domain Sequences for d3hgmc_:
Sequence, based on SEQRES records: (download)
>d3hgmc_ c.26.2.0 (C:) automated matches {Halomonas elongata [TaxId: 2746]}
mfnrimvpvdgskgavkalekgvglqqltgaelyilcvfkhhslleaslsmarpeqldip
ddalkdyateiavqaktratelgvpadkvrafvkggrpsrtivrfarkrecdlvvigaqg
tngdkslllgsvaqrvagsahcpvlvv
>d3hgmc_ c.26.2.0 (C:) automated matches {Halomonas elongata [TaxId: 2746]}
mfnrimvpvdgskgavkalekgvglqqltgaelyilcvfkhaslsmarpeqlpddalkdy
ateiavqaktratelgvpadkvrafvkggrpsrtivrfarkrecdlvvigaqgtnglgsv
aqrvagsahcpvlvv
Timeline for d3hgmc_: