SCOPe 2.07: Domain d3hfka1: 3hfk A:1-107

Lineage for d3hfka1 (3hfk A:1-107)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.19: MmlI-like [160292] (2 proteins)
   Pfam PF09448; Methylmuconolactone methyl-isomerase

6. Protein automated matches [191090] (1 species)
   not a true protein

7. Species Pseudomonas reinekei [TaxId:395598] [189060] (3 PDB entries)

8. Domain d3hfka1: 3hfk A:1-107 [177536]
   Other proteins in same PDB: d3hfka2, d3hfkb2, d3hfkc2, d3hfkd2
   automated match to d2ifxb1
   complexed with 4ml

Details for d3hfka1

PDB Entry: 3hfk, 1.9 Å

PDB Description: crystal structure of 4-methylmuconolactone methylisomerase (h52a) in complex with 4-methylmuconolactone

PDB Compounds: (A:) 4-methylmuconolactone methylisomerase

SCOPe Domain Sequences for d3hfka1:

Sequence; same for both SEQRES and ATOM records:

>d3hfka1 d.58.4.19 (A:1-107) automated matches {Pseudomonas reinekei [TaxId: 395598]}
mirilyllvkpesmsheqfrkecvvhfqmsagmpglhkyevrlvagnptdtavpyldvgr
idaigecwfaseeqyqvymesdirkawfehgkyfigqlkpfvteelv

Timeline for d3hfka1:

• d3hfka1 first appeared in SCOPe 2.01, called d3hfka_
  
• d3hfka1 appears in SCOPe 2.06
  
• d3hfka1 appears in the current release, SCOPe 2.08